PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA01G0077900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Nin-like
Protein Properties Length: 941aa    MW: 102756 Da    PI: 5.9615
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA01G0077900.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.61.2e-28595646152
             RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        aek+isl++l++yFs+++k+AAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  ORGLA01G0077900.1 595 AEKTISLDVLQQYFSGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 646
                        589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.541585666IPR003035RWP-RK domain
PfamPF020426.5E-26598646IPR003035RWP-RK domain
SuperFamilySSF542772.35E-21837932No hitNo description
PfamPF005641.8E-15847928IPR000270PB1 domain
SMARTSM006667.4E-25847929IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2403.1E-25847928No hitNo description
PROSITE profilePS5174518.698847929IPR000270PB1 domain
CDDcd064071.79E-33848928No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0010118Biological Processstomatal movement
GO:0010167Biological Processresponse to nitrate
GO:0042128Biological Processnitrate assimilation
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 941 aa     Download sequence    Send to blast
MEVDPSSSSP GAGEGGGGGI GGGGGDLWPF DSLTTSLLFS SVSASPQPLP ASSSSWLTPP  60
SPLWLFDERQ LLPLDMGAPA APATAPPAEA AAVVEEVHRT RSGNSDTTSK RVDQINSKWQ  120
FHLSIDDNTD SSCLFKERLT QALRYFKEST DQHLLVQVWA PVKSGDRYVL TTSGQPFVLD  180
QQSIGLLQYR AVSMMYMFSV DGENAGELGL PGRVYKQKVP EWTPNVQYYS STEYPRLNHA  240
ISYNVHGTVA LPVFDPSVQN CIAVVELIMT SKKINYAGEV DKVCKALEAV NLKSTEILDH  300
PNVQICNEGR QSALVEILEI LTVVCEEHKL PLAQTWVPCK YRSVLAHGGG VKKSCLSFDG  360
SCMGEVCMST SDVAFHVIDA HMWGFRDACV EHHLQKGQGV SGKAFIYRRP CFSKDISQFC  420
KLEYPLVHYA RMFGLAGCFA ICLQSMYTGD DDYILEFFLP PNCRNEDDQN ALLESILARM  480
KKCLRTLKVV GNGDTNEVCL QISNVLIIET EDLKTNVHFE NSEGCFRESP ESNGSQRAHE  540
VDNDGNKVSI MSERHLLADD NSQNNGASVG RPNGSGASDS LHKSNKPPER RRGKAEKTIS  600
LDVLQQYFSG SLKNAAKSLG VCPTTMKRIC RQHGISRWPS RKINKVNRSL SKLKQVIESV  660
QGSDAAFNLT SITGPLPIPV GPSSDSQNLE KASPNKVAEL SNLAVEGDRD SSLQKPIEND  720
NLAILMSQQG FIDANNNLQL EADKASHSRS SSGEGSINSR TSEASCQGSP ANQTFVCKPI  780
ASTFAEPQLI PEAFTKEPFQ EPALPLSRML IEDSGSSKDL KNLFTSAVDQ PFLARSSNLA  840
LMQNSGTVTI KASFKEDIVR FRFPCSGSVT ALKDEVAKRL RMDVGMFDIK YLDDDHEWVK  900
LACNADLEEC MEISRHSGSH VIRLLVSDVA AHLGSSCGSS G
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00449DAPTransfer from AT4G24020Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0673190.0AK067319.1 Oryza sativa Japonica Group cDNA clone:J013106K21, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613020.10.0PREDICTED: protein NLP3
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLI1NLN90.0I1NLN9_ORYGL; Uncharacterized protein
STRINGORGLA01G0077900.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7